PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_305431g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 696aa    MW: 76893.1 Da    PI: 7.7674
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_305431g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-211873156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r++ +++t++q++eLe+lF+k+++p++++r +L++ lgL+ rqVk+WFqNrR+++k
  MA_305431g0010 18 RKRYHRHTAHQIQELEALFKKHPHPDEKQRLQLSRDLGLEPRQVKFWFQNRRTQMK 73
                    789999***********************************************998 PP

2START165.44.1e-522104332206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la  a +e+  +a  +ep+W + +    + +  + + ++f+++         + e+ r+sg+v+ + + l  +++d++ +W e+++    ka+t+
  MA_305431g0010 210 LAINAVDEVTHLAHTNEPLWIRNVndnkDVLSLECYSKIFPRA-MeskaynVRKEVTRESGLVILNGHSLADIFMDTN-KWIEMFPtivaKAKTV 302
                     677889999999************6543333333344444443.36888888889*************9999999999.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+ +g      g lqlm+ael +ls+lv  R+ +f+Ry+ q+++g w+ivdvSvds  ++p ++s+ R+++lpSg++i++++ng+skvtw+ehv
  MA_305431g0010 303 EVLIPGqpgnrhGSLQLMYAELHVLSHLVLpREIYFLRYCHQSPEGIWAIVDVSVDSIMQNP-QASLSRCRKLPSGLVIQDMPNGYSKVTWIEHV 396
                     ***************************9966*******************************.9******************************* PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ++++r   + ++r+lv sg+a+ga++w+atlqr+ce+
  MA_305431g0010 397 EPEDRAGvQRMYRQLVDSGMAFGAQRWLATLQRNCER 433
                     ****9988***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-22469IPR009057Homeodomain-like
SuperFamilySSF466891.55E-20875IPR009057Homeodomain-like
PROSITE profilePS5007117.9611575IPR001356Homeobox domain
SMARTSM003891.3E-191679IPR001356Homeobox domain
PfamPF000463.5E-191873IPR001356Homeobox domain
CDDcd000861.18E-181875No hitNo description
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084848.617200436IPR002913START domain
SuperFamilySSF559612.47E-35203435No hitNo description
CDDcd088757.14E-105204432No hitNo description
SMARTSM002343.2E-39209433IPR002913START domain
PfamPF018521.7E-44210433IPR002913START domain
Gene3DG3DSA:3.30.530.202.6E-7278428IPR023393START-like domain
SuperFamilySSF559613.3E-18452688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MEGSGSDQDA ADQQNPARKR YHRHTAHQIQ ELEALFKKHP HPDEKQRLQL SRDLGLEPRQ  60
VKFWFQNRRT QMKAQGERAD NNTLRAENER IRGENLAIRE ALKYVLCSNC GGPPPGETSF  120
EEQQRLRLEN ARLKEELDRL SGIAAKYIGR PIQTTSPLHP ISMPSLDLGV VGYGVQNVGP  180
STDIISSGQS LTDFAMPTGS SLEKNLIREL AINAVDEVTH LAHTNEPLWI RNVNDNKDVL  240
SLECYSKIFP RAMESKAYNV RKEVTRESGL VILNGHSLAD IFMDTNKWIE MFPTIVAKAK  300
TVEVLIPGQP GNRHGSLQLM YAELHVLSHL VLPREIYFLR YCHQSPEGIW AIVDVSVDSI  360
MQNPQASLSR CRKLPSGLVI QDMPNGYSKV TWIEHVEPED RAGVQRMYRQ LVDSGMAFGA  420
QRWLATLQRN CERLASLMAT NIAARELGVS SPDERRFLMK LAQRMTSSFC ANISASTPHR  480
WSAASGSNDD GVRLTTRKNT GTTGSVLSAA ISLWLPVSPQ RVFDYFRDKR NRPQWDAVSG  540
GNSTEEVVNI ANGSHPGNCI TLLRAFTAMQ NNLFIIQESC TDSSGSLIVY APVDINAMKA  600
AMNNGGDPSI IPVLPSGISI LPDGPDNRRL QASSSNSSSM GSPGNTGGGS LLTVVFEISI  660
GNSPSPHMDP YNAKTVNQIV CNAVQQIKAA LHCLDV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011625255.10.0PREDICTED: homeobox-leucine zipper protein ROC8 isoform X3
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A0C9QWV40.0A0A0C9QWV4_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_2540_2939 transcribed RNA sequence
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11